LL-37 (10mg)

$100.00

  • Money Back Guarantee
  • Top Quality Vegan Item
  • Fast & Secure Checkout

product description

LL-37 (10mg)

Product Specifications
CAS Number 154947-66-7
Molecular Formula C205H340N60O53
Molecular Weight (g/mol) 4493.27
Amino Acid Count 37
Amino Acid Sequence H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH ([LL-37, 37 aa])
Purity ≥99% by HPLC | COA available
Physical Form Lyophilized powder
Solubility Soluble in bacteriostatic water; consult COA for specific solvent recommendations
Storage Conditions Store at -20°C; protect from light and moisture; reconstitute with bacteriostatic water

For Research Use Only. Not for use in diagnostic, therapeutic, or human or animal in-vivo procedures.

This product is sold exclusively for in-vitro laboratory research use. It is not a drug, dietary supplement, food, or cosmetic and has not been approved by the U.S. Food and Drug Administration for any use. This product is not intended to diagnose, treat, cure, mitigate, or prevent any disease. Not for human or animal consumption.

additional information

Title

Default Title

product reviews