P21 / BDNF (Brain-derived neurotrophic factor) (10mg)
$150.00
product description
P21 / BDNF (Brain-derived neurotrophic factor) (10mg)
| Product Specifications | |
|---|---|
| CAS Number | Not assigned (recombinant protein) |
| Molecular Formula | Recombinant protein; mature BDNF is 119 aa, ~13.5 kDa monomer (functions as homodimer ~27 kDa) |
| Molecular Weight (g/mol) | ~13,500 g/mol (monomer); ~27,000 g/mol (homodimer) |
| Amino Acid Count | 119 (mature) |
| Amino Acid Sequence | Mature human BDNF: HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR (UniProt P23560) |
| Purity | ≥99% by HPLC | COA available |
| Physical Form | Lyophilized powder |
| Solubility | Soluble in bacteriostatic water; consult COA for specific solvent recommendations |
| Storage Conditions | Store at -20°C; protect from light and moisture; reconstitute with bacteriostatic water |
For Research Use Only. Not for use in diagnostic, therapeutic, or human or animal in-vivo procedures.
This product is sold exclusively for in-vitro laboratory research use. It is not a drug, dietary supplement, food, or cosmetic and has not been approved by the U.S. Food and Drug Administration for any use. This product is not intended to diagnose, treat, cure, mitigate, or prevent any disease. Not for human or animal consumption.
additional information
| Title | Default Title |
|---|
product reviews
related vegan products
$799.00
$799.00
$240.00
